Edit |   |
---|---|
Antigenic Specificity | NCAM / CD56 (aa759-858) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 ul |
Concentration | n/a |
Applications | IHC, IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NCAM / CD56 Antibody (aa759-858) |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 (NP_851996.2). LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA |
Other Names | NCAM1, CD56, CD56 antigen, MSK39, NCAM-1, N-CAM-1, NCAM |
Gene, Accession # | n/a |
Catalog # | orb1536613 |
Price | $635 |
Order / More Info | NCAM / CD56 (aa759-858) Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558