AP2M1 Antibody from BIORBYT LTD.
Search, find, compare suppliers for anti-AP2M1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | AP2M1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 10 ug, 100 ug |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | AP2M1 Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences. |
| Other Names | AP-2 complex subunit mu;AP-2 mu chain;Adaptin-mu2;Adaptor protein complex AP-2 subunit mu;Adaptor-related protein complex 2 subunit mu;Clathrin assembly protein complex 2 mu medium chain;Clathrin coat assembly protein AP50;Clathrin coat-associated protein AP50;HA2 50 kDa subunit;Plasma membrane adaptor AP-2 50 kDa protein;AP2M1;CLAPM1, KIAA0109; |
| Gene, Accession # | UniProt: Q96CW1 |
| Catalog # | orb389389 |
| Price | $268 |
| Order / More Info | AP2M1 Antibody from BIORBYT LTD. |
| Product Specific References | n/a |
BIORBYT LTD.
BIORBYT LTD.
7 Signet Court
Swann Road
Cambridge, CB5 8LA U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240
info@biorbyt.com
http://www.biorbyt.com
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558
Profile of BIORBYT LTD.
Return to Antibodies