Edit |   |
---|---|
Antigenic Specificity | AQP4 / Aquaporin 4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 50 ul |
Concentration | n/a |
Applications | IHC, IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | AQP4 / Aquaporin 4 Antibody |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 244-323 of human AQP4 (NP_001641.1). AGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
Other Names | AQP4, Aquaporin type4, Aquaporin 4, Aquaporin-4, HMIWC2, MIWC, WCH4, AQP-4 |
Gene, Accession # | n/a |
Catalog # | orb1535806 |
Price | $635 |
Order / More Info | AQP4 / Aquaporin 4 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558