Edit |   |
---|---|
Antigenic Specificity | LRIG3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | LRIG3 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid. |
Other Names | Leucine-rich repeats and immunoglobulin-like domains protein 3;LIG-3;LRIG3;LIG3;UNQ287/PRO326/PRO335; |
Gene, Accession # | UniProt: Q6UXM1 |
Catalog # | orb381079 |
Price | $520 |
Order / More Info | LRIG3 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558