Edit |   |
---|---|
Antigenic Specificity | PCSK9 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, porcine |
Isotype | n/a |
Format | unconjugated |
Size | 100 ul |
Concentration | 0.5 mg/ml |
Applications | IHC-P |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal antibody to PCSK9 |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence RITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVP |
Other Names | n/a |
Gene, Accession # | UniProt: Q8NBP7 |
Catalog # | orb584825 |
Price | $609 |
Order / More Info | PCSK9 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558