Edit |   |
---|---|
Antigenic Specificity | CXCR4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | CXCR4 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. |
Other Names | C-X-C chemokine receptor type 4;CXC-R4;CXCR-4;FB22;Fusin;HM89;LCR1;Leukocyte-derived seven transmembrane domain receptor;LESTR;Lipopolysaccharide-associated protein 3;LAP-3;LPS-associated protein 3;NPYRL;Stromal cell-derived factor 1 receptor;SDF-1 receptor;CD184;CXCR4; |
Gene, Accession # | UniProt: P61073 |
Catalog # | orb18714 |
Price | $268 |
Order / More Info | CXCR4 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558