Edit |   |
---|---|
Antigenic Specificity | Alpha Amylase 1/AMY1A/AMY1B/AMY1C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. |
Other Names | Alpha-amylase 1;3.2.1.1;1,4-alpha-D-glucan glucanohydrolase 1;Salivary alpha-amylase;AMY1A;AMY1;AMY1B;AMY1;AMY1C;AMY1; |
Gene, Accession # | UniProt: P04745 |
Catalog # | orb18543 |
Price | $268 |
Order / More Info | Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558