Edit |   |
---|---|
Antigenic Specificity | GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | IF, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids. |
Other Names | Glutathione S-transferase A1; 2.5.1.18; GST HA subunit 1; GST class-alpha member 1; GST-epsilon; GSTA1-1; GTH1; Glutathione S-transferase A1, N-terminally processed; GSTA1; |
Gene, Accession # | UniProt: P08263 |
Catalog # | orb315135 |
Price | $520 |
Order / More Info | GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558