Edit |   |
---|---|
Antigenic Specificity | Cytochrome P450 17A1/CYP17A1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, ICC, IHC, IHC-Fr, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Cytochrome P450 17A1/CYP17A1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids. |
Other Names | Steroid 17-alpha-hydroxylase/17,20 lyase;1.14.14.19;17-alpha-hydroxyprogesterone aldolase;4.1.2.30;CYPXVII;Cytochrome P450 17A1;Cytochrome P450-C17;Cytochrome P450c17;Steroid 17-alpha-monooxygenase;CYP17A1;CYP17, S17AH; |
Gene, Accession # | UniProt: P05093 |
Catalog # | orb389397 |
Price | $520 |
Order / More Info | Cytochrome P450 17A1/CYP17A1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558