ZBTB7A Antibody from BIORBYT LTD.
Search, find, compare suppliers for anti-ZBTB7A antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ZBTB7A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | unconjugated |
| Size | 10 ug, 100 ug |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Applications | FC, ICC, IF, IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ZBTB7A Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids. |
| Other Names | Zinc finger and BTB domain-containing protein 7A;Factor binding IST protein 1;FBI-1;Factor that binds to inducer of short transcripts protein 1;HIV-1 1st-binding protein 1;Leukemia/lymphoma-related factor;POZ and Krueppel erythroid myeloid ontogenic factor;POK erythroid myeloid ontogenic factor;Pokemon;TTF-I-interacting peptide 21;TIP21;Zinc finger protein 857A;ZBTB7A;FBI1, LRF, ZBTB7, ZNF857A; |
| Gene, Accession # | UniProt: O95365 |
| Catalog # | orb334643 |
| Price | $268 |
| Order / More Info | ZBTB7A Antibody from BIORBYT LTD. |
| Product Specific References | n/a |
BIORBYT LTD.
BIORBYT LTD.
7 Signet Court
Swann Road
Cambridge, CB5 8LA U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240
info@biorbyt.com
http://www.biorbyt.com
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558
Profile of BIORBYT LTD.
Return to Antibodies