Edit |   |
---|---|
Antigenic Specificity | Bcl-X/BCL2L1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, ICC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Bcl-X/BCL2L1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences. |
Other Names | Bcl-2-like protein 1;Bcl2-L-1;Apoptosis regulator Bcl-X;BCL2L1;BCL2L, BCLX; |
Gene, Accession # | UniProt: Q07817 |
Catalog # | orb371651 |
Price | $268 |
Order / More Info | Bcl-X/BCL2L1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558