Edit |   |
---|---|
Antigenic Specificity | DR4/TNFRSF10A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, ICC, IF, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | DR4/TNFRSF10A Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL). |
Other Names | Tumor necrosis factor receptor superfamily member 10A;Death receptor 4;TNF-related apoptosis-inducing ligand receptor 1;TRAIL receptor 1;TRAIL-R1;CD261;TNFRSF10A;APO2, DR4, TRAILR1; |
Gene, Accession # | UniProt: O00220 |
Catalog # | orb389434 |
Price | $268 |
Order / More Info | DR4/TNFRSF10A Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558