Edit |   |
---|---|
Antigenic Specificity | PGP9.5 |
Clone | monoclonal |
Host Species | Mouse |
Reactive Species | human, mouse, rat |
Isotype | IgG1 |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | PGP9.5 Antibody (monoclonal, 3E4) |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids. |
Other Names | n/a |
Gene, Accession # | UniProt: P09936 |
Catalog # | orb763096 |
Price | $520 |
Order / More Info | PGP9.5 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558