Edit |   |
---|---|
Antigenic Specificity | Scavenging Receptor SR-BI/SCARB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, ICC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Scavenging Receptor SR-BI/SCARB1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid. |
Other Names | Scavenger receptor class B member 1;SRB1;SR-BI;Scarb1;Srb1; |
Gene, Accession # | UniProt: Q61009 |
Catalog # | orb308797 |
Price | $520 |
Order / More Info | Scavenging Receptor SR-BI/SCARB1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558