Edit |   |
---|---|
Antigenic Specificity | DDIT3 / CHOP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 50 ul |
Concentration | 2.75 mg/ml |
Applications | IF, IHC, IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | DDIT3 / CHOP Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human DDIT3 (NP_004074.2). GRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA |
Other Names | DDIT3, CHOP10, DDIT-3, CHOP, GADD153, C/EBP zeta, C/EBP-homologous protein, C/EBP-homologous protein 10, CHOP-10 |
Gene, Accession # | n/a |
Catalog # | orb1535627 |
Price | $635 |
Order / More Info | DDIT3 / CHOP Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558