Edit |   |
---|---|
Antigenic Specificity | 5HT2A Receptor/HTR2A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | 5HT2A Receptor/HTR2A Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. |
Other Names | 5-hydroxytryptamine receptor 2A;5-HT-2;5-HT-2A;Serotonin receptor 2A;HTR2A;HTR2; |
Gene, Accession # | UniProt: P28223 |
Catalog # | orb312125 |
Price | $268 |
Order / More Info | 5HT2A Receptor/HTR2A Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558