Edit |   |
---|---|
Antigenic Specificity | 5HT2A Receptor |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal antibody to HTR2A |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. |
Other Names | 5 HT 2, 5 HT 2A, 5 HT2 receptor, 5 HT2A, 5 hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled, 5-hydroxytryptamine 2A receptor, 5-hydroxytryptamine receptor 2A, 5HT2A_HUMAN, HTR 2, HTR 2A, HTR2, HTR2, formerly, HTR2A, serotonin 5-HT-2 receptor, formerly, serotonin 5-HT-2A receptor, Serotonin receptor 2A |
Gene, Accession # | n/a |
Catalog # | orb1177025 |
Price | $578 |
Order / More Info | 5HT2A Receptor Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558