Heparanase 1/HPSE Antibody from BIORBYT LTD.
Search, find, compare suppliers for anti-Heparanase 1/HPSE antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Heparanase 1/HPSE |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 10 ug, 100 ug |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Heparanase 1/HPSE Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids. |
| Other Names | Heparanase;3.2.1.166;Endo-glucoronidase;Heparanase-1;Hpa1;Heparanase 8 kDa subunit;Heparanase 50 kDa subunit;HPSE;HEP, HPA, HPA1, HPR1, HPSE1, HSE1; |
| Gene, Accession # | UniProt: Q9Y251 |
| Catalog # | orb259604 |
| Price | $268 |
| Order / More Info | Heparanase 1/HPSE Antibody from BIORBYT LTD. |
| Product Specific References | n/a |
BIORBYT LTD.
BIORBYT LTD.
7 Signet Court
Swann Road
Cambridge, CB5 8LA U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240
info@biorbyt.com
http://www.biorbyt.com
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558
Profile of BIORBYT LTD.
Return to Antibodies