Edit |   |
---|---|
Antigenic Specificity | MEK3/MAP2K3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, ICC, IF, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | MEK3/MAP2K3 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence. |
Other Names | Dual specificity mitogen-activated protein kinase kinase 3;MAP kinase kinase 3;MAPKK 3;2.7.12.2;MAPK/ERK kinase 3;MEK 3;Stress-activated protein kinase kinase 2;SAPK kinase 2;SAPKK-2;SAPKK2;MAP2K3;MEK3, MKK3, PRKMK3, SKK2; |
Gene, Accession # | UniProt: P46734 |
Catalog # | orb334495 |
Price | $520 |
Order / More Info | MEK3/MAP2K3 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558