Edit |   |
---|---|
Antigenic Specificity | ErbB 2/ERBB2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ErbB 2/ERBB2 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences. |
Other Names | Receptor tyrosine-protein kinase erbB-2;2.7.10.1;Metastatic lymph node gene 19 protein;MLN 19;Proto-oncogene Neu;Proto-oncogene c-ErbB-2;Tyrosine kinase-type cell surface receptor HER2;p185erbB2;CD340;ERBB2;HER2, MLN19, NEU, NGL; |
Gene, Accession # | UniProt: P04626 |
Catalog # | orb18775 |
Price | $268 |
Order / More Info | ErbB 2/ERBB2 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558