SLC12A2 Antibody from BIORBYT LTD.

Search, find, compare suppliers for anti-SLC12A2 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificitySLC12A2
Clonepolyclonal
Host SpeciesRabbit
Reactive Speciescanine, equine, guinea pig, human, mouse, porcine, rat, zebrafish
Isotypen/a
FormatProtein A purified
Size100 ul
Concentrationn/a
ApplicationsWB
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit polyclonal antibody to SLC12A2
ImmunogenSynthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
Other Namesanti BSC, BSC2, MGC104233, NKCC1
Gene, Accession #Gene ID: 6558, NCBI: NM_001046; NP_001037, UniProt: P55011
Catalog #orb330344
Price$489 / €417 / £288
Order / More InfoSLC12A2 Antibody from BIORBYT LTD.
Product Specific Referencesn/a
BIORBYT LTD.
BIORBYT LTD.
BIORBYT LTD.
5 Orwell Furlong
Cowley Road
Cambridge, Cambridgeshire CB4 0WY U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240

info@biorbyt.com

http://www.biorbyt.com

U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558


Profile of BIORBYT LTD.
Return to Antibodies

© 1980 - 2021 Linscott's Directory, Linscott's USA. All rights reserved.