Edit |   |
---|---|
Antigenic Specificity | APH1a |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal antibody to APH1A |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid. |
Other Names | 6530402N02Rik, AL138795.3, Anterior Pharynx Defective 1, Anterior pharynx defective 1 homolog A, APH 1A, Aph 1alpha, APH-1a, Aph-1alpha, Aph1a, APH1A gamma secretase subunit, APH1A_HUMAN, CGI 78, CGI78, Gamma secretase subunit APH 1A, Gamma Secretase Subunit APH1a, Gamma-secretase subunit APH-1A, Likely ortholog of C. elegans anterior pharynx defective 1A, Presenilin Stabilization Factor, Presenilin-stabilization factor, PSF, UNQ579/PRO1141 |
Gene, Accession # | n/a |
Catalog # | orb1176921 |
Price | $578 |
Order / More Info | APH1a Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558