Edit |   |
---|---|
Antigenic Specificity | ARID1A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ARID1A Antibody |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence. |
Other Names | AT-rich interactive domain-containing protein 1A;ARID domain-containing protein 1A;B120;BRG1-associated factor 250;BAF250;BRG1-associated factor 250a;BAF250A;Osa homolog 1;hOSA1;SWI-like protein;SWI/SNF complex protein p270;SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1;hELD;ARID1A;BAF250, BAF250A, C1orf4, OSA1, SMARCF1; |
Gene, Accession # | UniProt: O14497 |
Catalog # | orb316548 |
Price | $268 |
Order / More Info | ARID1A Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558