Edit |   |
---|---|
Antigenic Specificity | CD284 |
Clone | polyclonal |
Host Species | Goat |
Reactive Species | human |
Isotype | n/a |
Format | purified |
Size | 0.1 mg |
Concentration | 1.0mg/ml |
Applications | IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Goat polyclonal antibody to CD284 |
Immunogen | Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284. |
Other Names | TLR4 |
Gene, Accession # | n/a |
Catalog # | orb431067 |
Price | $595 |
Order / More Info | CD284 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558