Edit |   |
---|---|
Antigenic Specificity | SYP / Synaptophysin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 50 ul |
Concentration | n/a |
Applications | IF, IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SYP / Synaptophysin Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SYP (NP_003170.1). AFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAY |
Other Names | SYP, MRX, Synaptophysin, MRXSYP |
Gene, Accession # | n/a |
Catalog # | orb1537420 |
Price | $635 |
Order / More Info | SYP / Synaptophysin Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558