Edit |   |
---|---|
Antigenic Specificity | Eph receptor B1/EPHB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Eph receptor B1/EPHB1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences. |
Other Names | Ephrin type-B receptor 1;2.7.10.1;ELK;EPH tyrosine kinase 2;EPH-like kinase 6;EK6;hEK6;Neuronally-expressed EPH-related tyrosine kinase;NET;Tyrosine-protein kinase receptor EPH-2;EPHB1;ELK, EPHT2, HEK6, NET; |
Gene, Accession # | UniProt: P54762 |
Catalog # | orb312110 |
Price | $268 |
Order / More Info | Eph receptor B1/EPHB1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558