APLP1 Antibody from BIORBYT LTD.
Search, find, compare suppliers for anti-APLP1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | APLP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 100 ug |
| Concentration | n/a |
| Applications | IHC-P, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal antibody to APLP1 |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids. |
| Other Names | AMYLOID BETA A4 PRECURSOR-LIKE PROTEIN 1, AMYLOID PRECURSOR-LIKE PROTEIN, Amyloid-like protein 1 precursor, APLP 1, APLP, APLP-1, Aplp1, APLP1_HUMAN, C30 |
| Gene, Accession # | n/a |
| Catalog # | orb1176918 |
| Price | $578 |
| Order / More Info | APLP1 Antibody from BIORBYT LTD. |
| Product Specific References | n/a |
BIORBYT LTD.
BIORBYT LTD.
7 Signet Court
Swann Road
Cambridge, CB5 8LA U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240
info@biorbyt.com
http://www.biorbyt.com
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558
Profile of BIORBYT LTD.
Return to Antibodies