Kv1.4/KCNA4 Antibody from BIORBYT LTD.
Search, find, compare suppliers for anti-Kv1.4/KCNA4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Kv1.4/KCNA4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | unconjugated |
| Size | 10 ug, 100 ug |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Kv1.4/KCNA4 Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. |
| Other Names | Potassium voltage-gated channel subfamily A member 4;HPCN2;Voltage-gated K (+) channel HuKII;Voltage-gated potassium channel HBK4;Voltage-gated potassium channel HK1;Voltage-gated potassium channel subunit Kv1.4;KCNA4;KCNA4L; |
| Gene, Accession # | UniProt: P22459 |
| Catalog # | orb334539 |
| Price | $268 |
| Order / More Info | Kv1.4/KCNA4 Antibody from BIORBYT LTD. |
| Product Specific References | n/a |
BIORBYT LTD.
BIORBYT LTD.
7 Signet Court
Swann Road
Cambridge, CB5 8LA U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240
info@biorbyt.com
http://www.biorbyt.com
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558
Profile of BIORBYT LTD.
Return to Antibodies