Edit |   |
---|---|
Antigenic Specificity | CD45/PTPRC |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, IF, IHC, IHC-Fr, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | CD45/PTPRC Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CD45 (1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids. |
Other Names | Receptor-type tyrosine-protein phosphatase C;3.1.3.48;Leukocyte common antigen;L-CA;T200;CD45;PTPRC;CD45; |
Gene, Accession # | UniProt: P08575 |
Catalog # | orb334517 |
Price | $268 |
Order / More Info | CD45/PTPRC Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558