Edit |   |
---|---|
Antigenic Specificity | TIM 1/HAVCR1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | TIM 1/HAVCR1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD). |
Other Names | Hepatitis A virus cellular receptor 1;HAVcr-1;Kidney injury molecule 1;KIM-1;T-cell immunoglobulin and mucin domain-containing protein 1;TIMD-1;T-cell immunoglobulin mucin receptor 1;TIM;TIM-1;T-cell membrane protein 1;HAVCR1;KIM1, TIM1, TIMD1; |
Gene, Accession # | UniProt: Q96D42 |
Catalog # | orb316540 |
Price | $268 |
Order / More Info | TIM 1/HAVCR1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558