Edit |   |
---|---|
Antigenic Specificity | PD-1/PDCD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | n/a |
Applications | FC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | PD-1/PDCD1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse PD1 (84-117aa NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND), different from the related human sequence by fifteen amino acids. |
Other Names | n/a |
Gene, Accession # | UniProt: Q02242 |
Catalog # | orb1145869 |
Price | $268 |
Order / More Info | PD-1/PDCD1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558