Edit |   |
---|---|
Antigenic Specificity | RanBP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RanBP2 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE), different from the related mouse sequence by nine amino acids. |
Other Names | E3 SUMO-protein ligase RanBP2;6.3.2.-;358 kDa nucleoporin;Nuclear pore complex protein Nup358;Nucleoporin Nup358;Ran-binding protein 2;RanBP2;p270;RANBP2;NUP358; |
Gene, Accession # | UniProt: P49792 |
Catalog # | orb402426 |
Price | $268 |
Order / More Info | RanBP2 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558