Edit |   |
---|---|
Antigenic Specificity | SARS-CoV-2 NSP8 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 µg |
Concentration | +0.2 ml water yields 500 µg/ml. |
Applications | ELISA |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Boster Bio Anti-SARS-CoV-2 NSP8 Antibody catalog # A34002. Tested in ELISA applications. This antibody reacts with Human. |
Immunogen | AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
Other Names | n/a |
Gene, Accession # | rep, UniProt: P0DTC1/P0DTD1 |
Catalog # | A34002 |
Price | $415 |
Order / More Info | SARS-CoV-2 NSP8 Antibody from BOSTER BIO |
Product Specific References | n/a |