GCLM Antibody from BOSTER BIO

Search, find, compare suppliers for anti-GCLM antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityGCLM
Clonepolyclonal
Host SpeciesRabbit
Reactive Specieshuman, mouse, rat
Isotypen/a
Formataffinity purified
Size100ul
Concentration>0.5mg/ml.
ApplicationsIHC, WB
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit Polyclonal antibody for GCLM detection. Tested positive for IHC, WB in Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GCLM Synthetic peptide KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
Other Namesn/a
Gene, Accession #GCLM, UniProt: P48507
Catalog #A02948-1
Price$299
Order / More InfoGCLM Antibody from BOSTER BIO
Product Specific Referencesn/a
BOSTER BIO
BOSTER BIO
BOSTER BIO
3942 B Valley Ave
Pleasanton CA 94566
P: (888) 466-3604
F: (925) 215-2184

orders@bosterbio.com

http://www.bosterbio.com

Profile of BOSTER BIO
Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.