PD1 Antibody from BOSTER BIO

Search, find, compare suppliers for anti-PD1 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityPD1
Clonepolyclonal
Host SpeciesRabbit
Reactive Speciesmouse, rat
Isotypen/a
Formatimmunogen affinity purified
Size100µg (30ug sample)
ConcentrationAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
ApplicationsIHC, WB
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionPicoband™ Polyclonal antibody for PD 1/Pdcd1 detection. Host: Rabbit.Size: 100µg/vial. Tested applications: IHC-P. Reactive species: Mouse. PD 1/Pdcd1 information: Molecular Weight: 31842 MW; Subcellular Localization: Membrane; Single-pass type I membrane protein; Tissue Specificity: Thymus. No cross reactivity with other proteins. PDCD1 (Programmed cell death 1), also called PD1, encodes a cell surface receptor that is a member of the B7 superfamily involved in immunomodulation. This gene is mapped to 2q37.3. PDCD1 acts as an inhibitory molecule on T cells after interacting with its ligands PDL1 and PDL2. The PDCD1 gene contains 5 exons. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. Using flow
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of mouse PD1 (84-117aa NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND), different from the related human sequence by fifteen amino acids.
Other NamesProgrammed cell death protein 1;Protein PD-1;mPD-1;CD279;Pdcd1;Pd1;
Gene, Accession #Pdcd1, UniProt: Q02242
Catalog #A00178
Price$280
Order / More InfoPD1 Antibody from BOSTER BIO
Product Specific Referencesn/a
BOSTER BIO
BOSTER BIO
BOSTER BIO
3942 B Valley Ave
Pleasanton CA 94566
P: (888) 466-3604
F: (925) 215-2184

orders@bosterbio.com

http://www.bosterbio.com

Profile of BOSTER BIO
Return to Antibodies

© 1980 - 2019 Linscott's Directory, Linscott's USA. All rights reserved.