TRPV4 Antibody from BOSTER BIO

Search, find, compare suppliers for anti-TRPV4 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityTRPV4
Clonepolyclonal
Host SpeciesRabbit
Reactive Specieshuman, mouse, rat
Isotypen/a
Formataffinity purified
Size100ul
Concentration>0.5mg/ml.
ApplicationsIHC, WB
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionRabbit Polyclonal antibody for TRPV4 detection. Tested positive for IHC, WB in Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TRPV4 Synthetic peptide RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Other Namesn/a
Gene, Accession #TRPV4, UniProt: Q9HBA0-2
Catalog #A00565
Price$299
Order / More InfoTRPV4 Antibody from BOSTER BIO
Product Specific Referencesn/a
BOSTER BIO
BOSTER BIO
BOSTER BIO
3942 B Valley Ave
Pleasanton CA 94566
P: (888) 466-3604
F: (925) 215-2184

orders@bosterbio.com

http://www.bosterbio.com

Profile of BOSTER BIO
Return to Antibodies

© 1980 - 2020 Linscott's Directory, Linscott's USA. All rights reserved.