Toll-like Receptor 4 TLR4 Antibody from BOSTER BIO
Search, find, compare suppliers for anti-Toll-like Receptor 4 TLR4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Toll-like Receptor 4 TLR4 |
| Clone | polyclonal |
| Host Species | Goat |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | Epitope-affinity purified IgG. |
| Size | 200 µl |
| Concentration | n/a |
| Applications | IF, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog # A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse. |
| Immunogen | Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4) . |
| Other Names | n/a |
| Gene, Accession # | TLR4, UniProt: O00206 |
| Catalog # | A00017 |
| Price | $534 |
| Order / More Info | Toll-like Receptor 4 TLR4 Antibody from BOSTER BIO |
| Product Specific References | n/a |
BOSTER BIO
BOSTER BIO
3942 B Valley Ave
Pleasanton CA 94566
P: (888) 466-3604
F: (925) 215-2184
orders@bosterbio.com
http://www.bosterbio.com
Profile of BOSTER BIO
Return to Antibodies