Edit |   |
---|---|
Antigenic Specificity | KCNA2 |
Clone | K14/16 |
Host Species | n/a |
Reactive Species | human; rat; mouse; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; IP; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-Kv1.2 potassium channel subunit BBB Shuttle Antibody, Clone K14/16 |
Immunogen | Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480) Mouse: 100% identity (72/72 amino acids identical) Rat: 100% identity (72/72 amino acids identical) Some identity with Kv1.1, Kv1.3 and Kv1.4 |
Other Names | KCNA2; Potassium voltage-gated channel; shaker-related subfamily; member 2 |
Gene, Accession # | UniProt: P16389 |
Catalog # | NRZP-0423-ZP203 |
Price | please inquire |
Order / More Info | KCNA2 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |