Edit |   |
---|---|
Antigenic Specificity | KCNJ4 |
Clone | N25/35 |
Host Species | n/a |
Reactive Species | human; rat; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-Kir2.3 potassium channel BBB Shuttle Antibody, Clone N25/35 |
Immunogen | Fusion protein amino acids 390-445 (cytoplasmic C-terminus, EAAAAAAVA AGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI) of human Kir2.3 (also known as Inward rectifier potassium channel subfamily J member 4, KCNJ4, Brain inwardly rectifying K(+) channel 2, Hippocampal inward rectifier, HIRK2, HRK1, HIR, IRK3 and BIR11, accession number P48050) Mouse: 94% identity (54/57 amino acids identical) Rat: 94% identity (54/57 amino acids identical) <50% identity with Kir2.1 and Kir2.2 |
Other Names | KCNJ4; HIR; HIRK2; HRK1; IRK-3; IRK3; Kir2.3; potassium voltage-gated channel subfamily J member 4; potassium inwardly rectifying channel subfamily J member 4 |
Gene, Accession # | UniProt: P48050 |
Catalog # | NRZP-0423-ZP194 |
Price | please inquire |
Order / More Info | KCNJ4 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |