Edit |   |
---|---|
Antigenic Specificity | S100A2 |
Clone | CBP10247 |
Host Species | Mouse |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; ELISA; ICC; IF; S-ELISA; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-S100A2 Antibody, Clone N15118P (CBP10247) |
Immunogen | S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
Other Names | CAN19; S100L |
Gene, Accession # | UniProt: P29034 |
Catalog # | NRZP-0822-ZP2375 |
Price | please inquire |
Order / More Info | S100A2 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |