Edit |   |
---|---|
Antigenic Specificity | ACTL6A |
Clone | CBP8137 |
Host Species | n/a |
Reactive Species | human; mouse; rat; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-BAF53a, Clone N336B/83 (CBP8137) |
Immunogen | Fusion protein amino acids 43-119 (MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENME AISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHP, actin subdomain 2) of human BAF53a (also known as 53 kDa BRG1-associated factor A, BRG1-associated factor 53A, Actin-like protein 6A, ArpNbeta, ACTL6A, INO80 complex subunit K and INO80K, accession number O96019) Mouse: 96% identity (74/77 amino acids identical) Rat: 94% identity (73/77 amino acids identical) >50% identity with BAF53a |
Other Names | ACTL6A; ACTL6; ARPN-BETA; Arp4; BAF53A; INO80K; actin like 6A; SMARCN1 |
Gene, Accession # | UniProt: O96019 |
Catalog # | NRP-0422-P36 |
Price | please inquire |
Order / More Info | ACTL6A Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |