Edit |   |
---|---|
Antigenic Specificity | KCNJ5 |
Clone | CBP810 |
Host Species | Mouse |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC-P; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Mouse Anti-KCNJ5 Monoclonal Antibody (CBP810) |
Immunogen | Recombinant fragment (GST-tag) corresponding to Human KCNJ5 aa 321-419. NCBI Accession No. NP_000881.3. Sequence: SYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEM KREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV Database link: P48544 |
Other Names | CIR; GIRK4; KATP1; KIR3.4; LQT13; potassium voltage-gated channel subfamily J member 5; potassium inwardly rectifying channel subfamily J member 5 |
Gene, Accession # | UniProt: UniProt: UniProt: P48548 |
Catalog # | NAB-0720-Z3048 |
Price | please inquire |
Order / More Info | KCNJ5 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |