Edit |   |
---|---|
Antigenic Specificity | KCNJ11 |
Clone | CBP8299 |
Host Species | n/a |
Reactive Species | rat; mouse; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-Kir6.2 potassium channel, Clone N363/71 (CBP8299) |
Immunogen | Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISP DSLS, cytoplasmic C-terminus) of rat Kir6.2 (also known as ATP-sensitive inward rectifier potassium channel 11, Potassium channel inwardly rectifying subfamily J member 11, IKATP, Kcnj11 and BIR, accession number P70673) Mouse: 100% identity (46/46 amino acids identical) Human: 89% identity (41/46 amino acids identical) <50% identity with Kir6.1 |
Other Names | KCNJ11; BIR; HHF2; IKATP; KIR6.2; MODY13; PHHI; TNDM3; potassium voltage-gated channel subfamily J member 11; potassium inwardly rectifying channel subfamily J member 11; PNDM2 |
Gene, Accession # | UniProt: P70673 |
Catalog # | NRP-0422-P198 |
Price | please inquire |
Order / More Info | KCNJ11 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |