Edit |   |
---|---|
Antigenic Specificity | PHOX2A |
Clone | CBP9934 |
Host Species | Mouse |
Reactive Species | human; rat; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; ELISA; ICC; IF; IHC; RNAi; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-PHOX2A Antibody, Clone N23449P (CBP9934) |
Immunogen | PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ |
Other Names | ARIX; FEOM2; NCAM2; PMX2A; CFEOM2 |
Gene, Accession # | UniProt: O14813 |
Catalog # | NRZP-0822-ZP1868 |
Price | please inquire |
Order / More Info | PHOX2A Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |