Edit |   |
---|---|
Antigenic Specificity | GRIA2 |
Clone | CBP8246 |
Host Species | n/a |
Reactive Species | rat; mouse; human; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; ICC; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-GluA2/GluR2 glutamate receptor, Clone L21/32 (CBP8246) |
Immunogen | Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGY NVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491) Mouse: 98% identity (49/50 amino acids identical) Human: 98% identity (49/50 amino acids identical) 100% identity between Flip and Flop isoforms >70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4 |
Other Names | GRIA2; GLUR2; GLURB; GluA2; GluR-K2; HBGR2; glutamate ionotropic receptor AMPA type subunit 2; gluR-B; gluR-2 |
Gene, Accession # | UniProt: P19491 |
Catalog # | NRP-0422-P145 |
Price | please inquire |
Order / More Info | GRIA2 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |