Edit |   |
---|---|
Antigenic Specificity | VP7 |
Clone | monoclonal |
Host Species | Recombinant Mouse |
Reactive Species | BTV-1 |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB, |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Recombinant Mouse Anti-BTV-1 VP7 Antibody (20A11). This product is a mouse monoclonal antibody that specifically recognizes GVTVSVGGVDMRAGRIIAWDGQAALQIHNPTQQN, which is an linear epitope on Core protein VP7 from Bluetongue virus-1. The VP7-binding antibody 20A11 is an epitope-specific antibody that can be used in western blotting. |
Immunogen | n/a |
Other Names | BTV-1 VP7; Bluetongue virus-1; BTV-1; VP7; Core protein VP7 |
Gene, Accession # | UniProt: P26560 |
Catalog # | EPAF-1515LC |
Price | please inquire |
Order / More Info | VP7 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |