Edit |   |
---|---|
Antigenic Specificity | TIMM8A |
Clone | CBP11407 |
Host Species | Mouse |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; ELISA; S-ELISA; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-TIMM8A Antibody, Clone N3419P (CBP11407) |
Immunogen | TIMM8A (AAH05236, 1 a.a. ~ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLNDKWVNEEIKKKIEKCLETNDNGNTTYQNLWDTAKAVVRGKFIAISTYIKKEEKLQINNLTMNLIELEN |
Other Names | Deafness dystonia protein 1; DFN1; MTS; TIM8; DDP; DDP1; X-linked deafness dystonia protein; Mitochondrial import inner membrane translocase subunit Tim8 A |
Gene, Accession # | UniProt: O60220 |
Catalog # | NRZP-0822-ZP4308 |
Price | please inquire |
Order / More Info | TIMM8A Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |