Edit |   |
---|---|
Antigenic Specificity | POU4F3 |
Clone | CBP9764 |
Host Species | Mouse |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; ELISA; ICC; IF; RNAi; S-ELISA; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-POU4F3 Antibody, Clone N16195P (CBP9764) |
Immunogen | POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF |
Other Names | BRN3C; DFNA15; DFNA42; DFNA52 |
Gene, Accession # | UniProt: Q15319 |
Catalog # | NRZP-0822-ZP1603 |
Price | please inquire |
Order / More Info | POU4F3 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |