Edit |   |
---|---|
Antigenic Specificity | GFAP |
Clone | CBP9465 |
Host Species | Mouse |
Reactive Species | human; mouse; rat; |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB; IHC; IHC-P; KD; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NeuroMab™ Anti-GFAP Antibody, Clone N26726P (CBP9465) |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD |
Other Names | Glial fibrillary acidic protein; ALXDRD; GFAP |
Gene, Accession # | UniProt: P14136 |
Catalog # | NRZP-0822-ZP1189 |
Price | please inquire |
Order / More Info | GFAP Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |