Edit |   |
---|---|
Antigenic Specificity | MZB1 |
Clone | monoclonal |
Host Species | Recombinant Rabbit |
Reactive Species | n/a |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | ELISA; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Recombinant Anti-MZB1 Antibody (V3S-1022-YC2399). This product is a recombinant Rabbit antibody provided by CreativeBiolabs. The antibody is specific for marginal zone B and B1 cell specific protein. It can be used for marginal zone B and B1 cell specific protein detection in Enzyme-Linked Immunosorbent Assay. It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultrapurified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
Immunogen | Human PACAP38 peptide: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
Other Names | PACAP; pERp1; MEDA-7 |
Gene, Accession # | UniProt: Q8WU39 |
Catalog # | V3S-1022-YC2399 |
Price | please inquire |
Order / More Info | MZB1 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |